(data stored in ACNUC7421 zone)

EMBL: AE006468.YBAM

AE006468.YBAM        Location/Qualifiers
FT   CDS             complement(538938..539105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaM"
FT                   /locus_tag="STM0480"
FT                   /product="putative inner membrane protein"
FT                   /note="similar to E. coli orf, hypothetical protein
FT                   (AAC73568.1); Blastp hit to AAC73568.1 (53 aa), 80%
FT                   identity in aa 1 - 49"
FT                   /db_xref="EnsemblGenomes-Gn:STM0480"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19434"
FT                   /db_xref="InterPro:IPR019630"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CR14"
FT                   /protein_id="AAL19434.1"
FT                   /translation="MSLENAPDEVKLAVDLIVLLEENRLPARTVLRALEIVMRDYENKL
FT                   KSTEDDSQTE"
     MSLENAPDEV KLAVDLIVLL EENRLPARTV LRALEIVMRD YENKLKSTED DSQTE             55
//

If you have problems or comments...

PBIL Back to PBIL home page