(data stored in ACNUC7421 zone)

EMBL: AE006468.YBBK

AE006468.YBBK        Location/Qualifiers
FT   CDS             complement(561425..562342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbK"
FT                   /locus_tag="STM0501"
FT                   /product="putative inner membrane protein"
FT                   /note="similar to E. coli putative protease (AAC73591.1);
FT                   Blastp hit to AAC73591.1 (305 aa), 95% identity in aa 1 -
FT                   302"
FT                   /db_xref="EnsemblGenomes-Gn:STM0501"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19455"
FT                   /db_xref="GOA:Q8ZR94"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR018080"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZR94"
FT                   /protein_id="AAL19455.1"
FT                   /translation="MLILIPILIFVALVIVGAGVKIVPQGYQWTVERFGRYTKTLQPGL
FT                   SLVVPFMDRIGRKINMMEQVLDIPSQEVISKDNANVTIDAVCFIQVIDAPRAAYEVSNL
FT                   ELAIINLTMTNIRTVLGSMELDEMLSQRDSINTRLLHIVDEATNPWGIKVTRIEIRDVR
FT                   PPAELISSMNAQMKAERTKRAYILEAEGVRQAEILKAEGEKQSQILKAEGERQSAFLQA
FT                   EARERSAEAEARATQMVSEAIAAGDIQAINYFVAQKYTEALQQIGSANNSKVVMMPLDA
FT                   SSLMGAIAGISELVKDSASERKKA"
     MLILIPILIF VALVIVGAGV KIVPQGYQWT VERFGRYTKT LQPGLSLVVP FMDRIGRKIN        60
     MMEQVLDIPS QEVISKDNAN VTIDAVCFIQ VIDAPRAAYE VSNLELAIIN LTMTNIRTVL       120
     GSMELDEMLS QRDSINTRLL HIVDEATNPW GIKVTRIEIR DVRPPAELIS SMNAQMKAER       180
     TKRAYILEAE GVRQAEILKA EGEKQSQILK AEGERQSAFL QAEARERSAE AEARATQMVS       240
     EAIAAGDIQA INYFVAQKYT EALQQIGSAN NSKVVMMPLD ASSLMGAIAG ISELVKDSAS       300
     ERKKA                                                                   305
//

If you have problems or comments...

PBIL Back to PBIL home page