(data stored in ACNUC7421 zone)

EMBL: AE006468.YLAB

AE006468.YLAB        Location/Qualifiers
FT   CDS             complement(524580..526130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ylaB"
FT                   /locus_tag="STM0468"
FT                   /product="putative diguanylate cyclase/phosphodiesterase
FT                   domain 2"
FT                   /note="similar to E. coli orf, hypothetical protein
FT                   (AAC73559.1); Blastp hit to AAC73559.1 (518 aa), 67%
FT                   identity in aa 3 - 518"
FT                   /db_xref="EnsemblGenomes-Gn:STM0468"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19422"
FT                   /db_xref="GOA:Q8ZRB0"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR024744"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRB0"
FT                   /protein_id="AAL19422.1"
FT                   /translation="MTTRHLVSLVTGVLILSVLFPIGLSLWLAHRQVEKRFNEELDIFS
FT                   SRVALRTERVSDQAKAALTHIASFKGEPCSSAHLLAMRRVSYSFRYVQEVLYLKNSIPV
FT                   CSSLEKESHIPAFPPPMKITRDGYRAWFTAQNDLGIKRYMAALGSDSYIVMIDPASFID
FT                   VIPFGAWPIDVAIIGRERNTVVASSGNLDPAILPLIHHETPLRLENRGIQYAIHPFPEM
FT                   GITIVSWAPTAPLERSWYRQAFIWLPAGIVTGLLAAAFILRILRRLQSPRHRLQDAIDN
FT                   REINVHYQPIVSLSSGKIVGAEALARWQQADGTFLSPEIFIALAEQTGLTEPLTRLIID
FT                   TVFEDMGSWLKSHPEQHISINLEASDLASETLPTLLSTLLNRSQISPSQIALELTEREF
FT                   ADPKTSAPIVARYRNAGHSIYIDDFGTGYSSLSYLQNLDVDVLKIDKSFVDALEYKNVT
FT                   PHIIEMAKTLKLKMVAEGIETARQEQWLRQHGVHYGQGWLYSKPLPATAFILWAEQRL"
     MTTRHLVSLV TGVLILSVLF PIGLSLWLAH RQVEKRFNEE LDIFSSRVAL RTERVSDQAK        60
     AALTHIASFK GEPCSSAHLL AMRRVSYSFR YVQEVLYLKN SIPVCSSLEK ESHIPAFPPP       120
     MKITRDGYRA WFTAQNDLGI KRYMAALGSD SYIVMIDPAS FIDVIPFGAW PIDVAIIGRE       180
     RNTVVASSGN LDPAILPLIH HETPLRLENR GIQYAIHPFP EMGITIVSWA PTAPLERSWY       240
     RQAFIWLPAG IVTGLLAAAF ILRILRRLQS PRHRLQDAID NREINVHYQP IVSLSSGKIV       300
     GAEALARWQQ ADGTFLSPEI FIALAEQTGL TEPLTRLIID TVFEDMGSWL KSHPEQHISI       360
     NLEASDLASE TLPTLLSTLL NRSQISPSQI ALELTEREFA DPKTSAPIVA RYRNAGHSIY       420
     IDDFGTGYSS LSYLQNLDVD VLKIDKSFVD ALEYKNVTPH IIEMAKTLKL KMVAEGIETA       480
     RQEQWLRQHG VHYGQGWLYS KPLPATAFIL WAEQRL                                 516
//

If you have problems or comments...

PBIL Back to PBIL home page