(data stored in ACNUC7421 zone)

EMBL: AE006468.YLAC

AE006468.YLAC        Location/Qualifiers
FT   CDS             complement(526817..527287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ylaC"
FT                   /locus_tag="STM0471"
FT                   /product="putative inner membrane protein"
FT                   /note="similar to E. coli orf, hypothetical protein
FT                   (AAC73560.1); Blastp hit to AAC73560.1 (169 aa), 80%
FT                   identity in aa 14 - 168"
FT                   /db_xref="EnsemblGenomes-Gn:STM0471"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19425"
FT                   /db_xref="GOA:Q8ZRA9"
FT                   /db_xref="InterPro:IPR019713"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRA9"
FT                   /protein_id="AAL19425.1"
FT                   /translation="MTEIQRLLSETIDDLNIREKRDNRPRFSISFIRKHPGLFIAMYAA
FT                   WFATLAVMLQSETLVGSVWLLVVLFIAFNGFFFFDIAPRYHYNDIDVLDLRVCYNGEWY
FT                   NTRFVPPTLIETILQSPQVDNEHKVQLQKMVARKGELSFYDIFTLARAEASR"
     MTEIQRLLSE TIDDLNIREK RDNRPRFSIS FIRKHPGLFI AMYAAWFATL AVMLQSETLV        60
     GSVWLLVVLF IAFNGFFFFD IAPRYHYNDI DVLDLRVCYN GEWYNTRFVP PTLIETILQS       120
     PQVDNEHKVQ LQKMVARKGE LSFYDIFTLA RAEASR                                 156
//

If you have problems or comments...

PBIL Back to PBIL home page