(data stored in SCRATCH3701 zone)

EMBL: AE017197.AAS

AE017197.AAS         Location/Qualifiers
FT   CDS             795116..798574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aas"
FT                   /locus_tag="RT0611"
FT                   /product="bifunctional protein Aas
FT                   (2-acylglycerophosphoethanolamine acyltransferase and
FT                   Acyl-acyl carrier protein synthetase)"
FT                   /db_xref="EnsemblGenomes-Gn:RT0611"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04075"
FT                   /db_xref="GOA:Q68WB7"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WB7"
FT                   /protein_id="AAU04075.1"
FT                   /translation="MNTNKLYLFKDRRFLPNFIIQLFGCLNDNILKNALVILITYGISE
FT                   TISKYNNVLVLIANATFVLPFIIFASIAGQIADKYERASLIKILKIYEIGIIAFAIYGF
FT                   HNNNLLILFCSICLMGIHSTFFGPIKYSVLPDHLNKDELLGANGFVEAATFIGIFIGTI
FT                   IGSYYTISNNFIIYSLMTIAFLGFITSLLSPKSKNANHNIKINFNIIDESINMIKYAKA
FT                   KKQIYLAILGISWFWFIGAAIIAQIPLLAKITFKADENVANLFLAVFSLGVGVGSFLCS
FT                   KIFEDEITVKYLFISALGISIFGIDLFFASRISSVNYEPTQLKSIFVFLSKRHNWRIVI
FT                   DLFFLAIISGLYIVPLFAILQHYANPAHRSRIIAANNLINSIFMVGSTIILSLLFYLNF
FT                   TIPWIILFISLANIVVTIYIYRLIPEVKIIPFKLLRRIFQICFDLMYKVEVKGFENFQK
FT                   AGKKVVVVANHISYLDPPLIATYLREEMIFAISPDIQKIWWIKPFLRMAKTLPVDPSNP
FT                   MAIKTLVKAVQKDQKIAIFPEGRISVTGSLMKIYEGPGMIADKADATLLPVRIDGTQFT
FT                   HLSKLKNILKKKIFPKITITVLPPVKFANIDTANNQARRSYISRTLYDIMADMMFESSD
FT                   YKNTLFSSLIEAAKIHGFKKKIVDDFEKNTVTYRDLIFKSFILGDLIKKNNIFDRHLGL
FT                   MLPNTTNTLITFYAMQSNGYVPAIINWSSAIGTITNCCKLAQIKVVYTSKEFIEKANLH
FT                   ELITHLLDLGIKIIYLEDFKNQISTALKLKAKIGSYFSQTYYNYFCHNRDDEKPAVIIF
FT                   TSGTEGEPKAVLLSHKNLQTNRYQITAKVPFSPEDIVFNSLPLFHSFGLGGAIITTLNG
FT                   IKLFLYPHALNYRSIPEAIYDIGATILISTDTFLKGYANYAHPYDFFSLRYIFAGNEKL
FT                   KETTRQFWLNKYGIRIFEGYGITEAAPIIACNTPMHNKAGTVGRLLPKIDYKLEKVAGI
FT                   NEGGRLFIKGPNIMLGYLDLEGHRSYQEWYDTGDIVKIDSEGYITILGRLKRFAKIAGE
FT                   MISLTKIEELASEIDPESLHAAISVQDKRYGAKIILLTTGSDINKENFTKMVSNAQISL
FT                   LHLPKLIITNSEIPLLASGKIDYLEIMKNRNLIDSRHSEHYSIER"
     MNTNKLYLFK DRRFLPNFII QLFGCLNDNI LKNALVILIT YGISETISKY NNVLVLIANA        60
     TFVLPFIIFA SIAGQIADKY ERASLIKILK IYEIGIIAFA IYGFHNNNLL ILFCSICLMG       120
     IHSTFFGPIK YSVLPDHLNK DELLGANGFV EAATFIGIFI GTIIGSYYTI SNNFIIYSLM       180
     TIAFLGFITS LLSPKSKNAN HNIKINFNII DESINMIKYA KAKKQIYLAI LGISWFWFIG       240
     AAIIAQIPLL AKITFKADEN VANLFLAVFS LGVGVGSFLC SKIFEDEITV KYLFISALGI       300
     SIFGIDLFFA SRISSVNYEP TQLKSIFVFL SKRHNWRIVI DLFFLAIISG LYIVPLFAIL       360
     QHYANPAHRS RIIAANNLIN SIFMVGSTII LSLLFYLNFT IPWIILFISL ANIVVTIYIY       420
     RLIPEVKIIP FKLLRRIFQI CFDLMYKVEV KGFENFQKAG KKVVVVANHI SYLDPPLIAT       480
     YLREEMIFAI SPDIQKIWWI KPFLRMAKTL PVDPSNPMAI KTLVKAVQKD QKIAIFPEGR       540
     ISVTGSLMKI YEGPGMIADK ADATLLPVRI DGTQFTHLSK LKNILKKKIF PKITITVLPP       600
     VKFANIDTAN NQARRSYISR TLYDIMADMM FESSDYKNTL FSSLIEAAKI HGFKKKIVDD       660
     FEKNTVTYRD LIFKSFILGD LIKKNNIFDR HLGLMLPNTT NTLITFYAMQ SNGYVPAIIN       720
     WSSAIGTITN CCKLAQIKVV YTSKEFIEKA NLHELITHLL DLGIKIIYLE DFKNQISTAL       780
     KLKAKIGSYF SQTYYNYFCH NRDDEKPAVI IFTSGTEGEP KAVLLSHKNL QTNRYQITAK       840
     VPFSPEDIVF NSLPLFHSFG LGGAIITTLN GIKLFLYPHA LNYRSIPEAI YDIGATILIS       900
     TDTFLKGYAN YAHPYDFFSL RYIFAGNEKL KETTRQFWLN KYGIRIFEGY GITEAAPIIA       960
     CNTPMHNKAG TVGRLLPKID YKLEKVAGIN EGGRLFIKGP NIMLGYLDLE GHRSYQEWYD      1020
     TGDIVKIDSE GYITILGRLK RFAKIAGEMI SLTKIEELAS EIDPESLHAA ISVQDKRYGA      1080
     KIILLTTGSD INKENFTKMV SNAQISLLHL PKLIITNSEI PLLASGKIDY LEIMKNRNLI      1140
     DSRHSEHYSI ER                                                          1152
//

If you have problems or comments...

PBIL Back to PBIL home page