(data stored in SCRATCH3701 zone)

EMBL: AE017197.ADDA

AE017197.ADDA        Location/Qualifiers
FT   CDS             613098..613790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="addA"
FT                   /locus_tag="RT0479"
FT                   /product="class II aldolase/adducin domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0479"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03951"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WP1"
FT                   /protein_id="AAU03951.1"
FT                   /translation="MDIKYNLAAAYRIMAYLSLDDHTYTHLSARSKNADFYYIYPFGLR
FT                   FEEVTTENLLKVSLDGKILEGEEYQYNKTGYFIHGSIYKARPDVFAIFHYHTPASIAVS
FT                   SLKCGLLPISQWALHFYDRISYHDYNSLVLDAGQSAKFVNDLKQNYVMLLRNHGAIICG
FT                   KTIHEAMFYTYHLEQACKTQCLLNSTIQQELIIPSVEICKKTVKDLLSFEEDLGKRDWE
FT                   AWLRLINM"
     MDIKYNLAAA YRIMAYLSLD DHTYTHLSAR SKNADFYYIY PFGLRFEEVT TENLLKVSLD        60
     GKILEGEEYQ YNKTGYFIHG SIYKARPDVF AIFHYHTPAS IAVSSLKCGL LPISQWALHF       120
     YDRISYHDYN SLVLDAGQSA KFVNDLKQNY VMLLRNHGAI ICGKTIHEAM FYTYHLEQAC       180
     KTQCLLNSTI QQELIIPSVE ICKKTVKDLL SFEEDLGKRD WEAWLRLINM                  230
//

If you have problems or comments...

PBIL Back to PBIL home page