(data stored in SCRATCH3701 zone)

EMBL: AE017197.ADK

AE017197.ADK         Location/Qualifiers
FT   CDS             complement(817256..817897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adk"
FT                   /locus_tag="RT0630"
FT                   /product="Adenylic kinase"
FT                   /EC_number="2.7.4.3"
FT                   /db_xref="EnsemblGenomes-Gn:RT0630"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04093"
FT                   /db_xref="GOA:Q68W99"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR007862"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68W99"
FT                   /protein_id="AAU04093.1"
FT                   /translation="MIVIFLGPPGAGKGTQGKKIAKKIDLPHIAVGDIFRTIIKTSTSE
FT                   AELINNYVKQGALIPNEIVNQVIKIFLLSSQYKNGYILDGYPRNLEQARFFESFIKKAQ
FT                   IKIIYFDVADELLIKRVLGRYSCKNCGKIYNVHFLQPKTDYVCDVCSSNVFDYRRDDNE
FT                   EVIKKRIEVYKTETYPLIDYYKNSGNFYIVNASKDEQEIENDIQKILKIN"
     MIVIFLGPPG AGKGTQGKKI AKKIDLPHIA VGDIFRTIIK TSTSEAELIN NYVKQGALIP        60
     NEIVNQVIKI FLLSSQYKNG YILDGYPRNL EQARFFESFI KKAQIKIIYF DVADELLIKR       120
     VLGRYSCKNC GKIYNVHFLQ PKTDYVCDVC SSNVFDYRRD DNEEVIKKRI EVYKTETYPL       180
     IDYYKNSGNF YIVNASKDEQ EIENDIQKIL KIN                                    213
//

If you have problems or comments...

PBIL Back to PBIL home page