(data stored in SCRATCH3701 zone)

EMBL: AE017197.AMPG1

AE017197.AMPG1       Location/Qualifiers
FT   CDS             complement(591272..592603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ampG1"
FT                   /locus_tag="RT0462"
FT                   /product="murein peptide permease protein AmpG"
FT                   /db_xref="EnsemblGenomes-Gn:RT0462"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03937"
FT                   /db_xref="GOA:Q68WQ5"
FT                   /db_xref="InterPro:IPR004752"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68WQ5"
FT                   /protein_id="AAU03937.1"
FT                   /translation="MLKNSHVCIIIWLFGFISGFNIMITGNTLNYWFAKKDIALQTIGI
FT                   LSFITLPYSINFLLAPVFDTVQIKCLNKILGHRLSWICLTSTTLISLTSILSFLDPGTD
FT                   LVLLSFIAFIISFFSATQDTILSALRTEIVPKELLGFTSGIYIFGYRVGMLLASSGAIY
FT                   LSIYLTFNKIYQIFACVIFVYLILLILVSRYTNSVDVIEENTSYFYVARCYTMEEMHLK
FT                   NEFFIKHYFNFFKNCISAYLLKIFSGSHVYRNDISLAYFIVLILIFLVLYRLPDNLINV
FT                   MINPFLLHLGYNAFEIASVCKFCGVIGAIIGGLIGGIIMKYKNMLYSILLFGIIHALSH
FT                   ILFILLEVNGKNSLILFITIGIESITGGMTMTAYIAFISSLCQGKFRATQYSLLSSMMG
FT                   ISRSIFPIISGYMVVNFGWQNFFLFTTIITIPSLLILLKIQTKL"
     MLKNSHVCII IWLFGFISGF NIMITGNTLN YWFAKKDIAL QTIGILSFIT LPYSINFLLA        60
     PVFDTVQIKC LNKILGHRLS WICLTSTTLI SLTSILSFLD PGTDLVLLSF IAFIISFFSA       120
     TQDTILSALR TEIVPKELLG FTSGIYIFGY RVGMLLASSG AIYLSIYLTF NKIYQIFACV       180
     IFVYLILLIL VSRYTNSVDV IEENTSYFYV ARCYTMEEMH LKNEFFIKHY FNFFKNCISA       240
     YLLKIFSGSH VYRNDISLAY FIVLILIFLV LYRLPDNLIN VMINPFLLHL GYNAFEIASV       300
     CKFCGVIGAI IGGLIGGIIM KYKNMLYSIL LFGIIHALSH ILFILLEVNG KNSLILFITI       360
     GIESITGGMT MTAYIAFISS LCQGKFRATQ YSLLSSMMGI SRSIFPIISG YMVVNFGWQN       420
     FFLFTTIITI PSLLILLKIQ TKL                                               443
//

If you have problems or comments...

PBIL Back to PBIL home page