(data stored in SCRATCH3701 zone)

EMBL: AE017197.APRD

AE017197.APRD        Location/Qualifiers
FT   CDS             complement(387489..389240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aprD"
FT                   /locus_tag="RT0305"
FT                   /product="alkaline proteinase secretion ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0305"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03785"
FT                   /db_xref="GOA:Q68X57"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010128"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:Q68X57"
FT                   /protein_id="AAU03785.1"
FT                   /translation="MDNKKNLNKKNPLVIALSECKTAFWIVFWFAFVINLLMLITPLYS
FT                   LQVLDRVLGSGNLQTLLFLSIIIAYIYFVYGLLQIARSFTLIKVGEWLDRTVAPVIFAS
FT                   SISATATRVNIGSSQLLRDFQAVKTFLTSTGINTLFDAPWSIIYIAVIFSIHPYIGFIT
FT                   IFGAIIIVSTAFFNAAATNKTLGEATEFSIKGMTQADIANRNAESIEAMGMMKNVTKNW
FT                   HKFNILALDKQSVASYRNGVISNFSRFVRNIMQMAVTGVGAYIVVKSHSADMTPGNMIM
FT                   SSIIVGRALAPFDNAIELWKSMSGAIKSYKNINNLFNTYSSRDEAMPIPNVNGHLTVEN
FT                   VYYAHPIPKHLSQPIVPKYILKGISFVVQPGEILAIIGPSATGKSTLAKIIVGVWKESS
FT                   GSVRLDSAEIYRWNREDFGKHVGYLPQGIELFSGSIKQNIARMEENADPQKVIEAAKIA
FT                   GAHEMILRFQDGYDTDIGPAGSNLSGGQRQRIGLARAFYGNPKLIILDEPNANLDEAGE
FT                   IALAMALKQAKLKGISVLVISHRPSVLSVVDKILILQDGSIAVYGTAEEIQKHLNTFKS
FT                   DTIHIKN"
     MDNKKNLNKK NPLVIALSEC KTAFWIVFWF AFVINLLMLI TPLYSLQVLD RVLGSGNLQT        60
     LLFLSIIIAY IYFVYGLLQI ARSFTLIKVG EWLDRTVAPV IFASSISATA TRVNIGSSQL       120
     LRDFQAVKTF LTSTGINTLF DAPWSIIYIA VIFSIHPYIG FITIFGAIII VSTAFFNAAA       180
     TNKTLGEATE FSIKGMTQAD IANRNAESIE AMGMMKNVTK NWHKFNILAL DKQSVASYRN       240
     GVISNFSRFV RNIMQMAVTG VGAYIVVKSH SADMTPGNMI MSSIIVGRAL APFDNAIELW       300
     KSMSGAIKSY KNINNLFNTY SSRDEAMPIP NVNGHLTVEN VYYAHPIPKH LSQPIVPKYI       360
     LKGISFVVQP GEILAIIGPS ATGKSTLAKI IVGVWKESSG SVRLDSAEIY RWNREDFGKH       420
     VGYLPQGIEL FSGSIKQNIA RMEENADPQK VIEAAKIAGA HEMILRFQDG YDTDIGPAGS       480
     NLSGGQRQRI GLARAFYGNP KLIILDEPNA NLDEAGEIAL AMALKQAKLK GISVLVISHR       540
     PSVLSVVDKI LILQDGSIAV YGTAEEIQKH LNTFKSDTIH IKN                         583
//

If you have problems or comments...

PBIL Back to PBIL home page