(data stored in SCRATCH3701 zone)

EMBL: AE017197.CCME

AE017197.CCME        Location/Qualifiers
FT   CDS             746571..746957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccmE"
FT                   /locus_tag="RT0577"
FT                   /product="cytochrome c-type biogenesis protein CcmE"
FT                   /db_xref="EnsemblGenomes-Gn:RT0577"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04042"
FT                   /db_xref="GOA:Q68WF0"
FT                   /db_xref="InterPro:IPR004329"
FT                   /db_xref="InterPro:IPR036127"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68WF0"
FT                   /protein_id="AAU04042.1"
FT                   /translation="MQKIVRNRLIKIILCFCSTCLGISIILYNLEKNIIFFFPPSKINE
FT                   AEQGKELRVGGLVKRDSINRISANKISFVITDNIKDLEILYQGVLPALFREGQGIIAIG
FT                   QLSDNKFIARQLLAKHDENYRPPS"
     MQKIVRNRLI KIILCFCSTC LGISIILYNL EKNIIFFFPP SKINEAEQGK ELRVGGLVKR        60
     DSINRISANK ISFVITDNIK DLEILYQGVL PALFREGQGI IAIGQLSDNK FIARQLLAKH       120
     DENYRPPS                                                                128
//

If you have problems or comments...

PBIL Back to PBIL home page