(data stored in SCRATCH3701 zone)

EMBL: AE017197.CYAY

AE017197.CYAY        Location/Qualifiers
FT   CDS             396596..396937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyaY"
FT                   /locus_tag="RT0313"
FT                   /product="CyaY protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0313"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03793"
FT                   /db_xref="GOA:Q68X49"
FT                   /db_xref="InterPro:IPR002908"
FT                   /db_xref="InterPro:IPR020895"
FT                   /db_xref="InterPro:IPR036524"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68X49"
FT                   /protein_id="AAU03793.1"
FT                   /translation="MILKTQKKNMNNTAFSKLAETTIVYIVDKIEEQDIEGIIDVDLHG
FT                   DILNLDTENGIYVINTQSASKEIWLSSPVSGPHHFFYEQGKWKSRIGFELMILLTEELG
FT                   IRFDKCEIF"
     MILKTQKKNM NNTAFSKLAE TTIVYIVDKI EEQDIEGIID VDLHGDILNL DTENGIYVIN        60
     TQSASKEIWL SSPVSGPHHF FYEQGKWKSR IGFELMILLT EELGIRFDKC EIF              113
//

If you have problems or comments...

PBIL Back to PBIL home page