(data stored in SCRATCH3701 zone)

EMBL: AE017197.ENVZ

AE017197.ENVZ        Location/Qualifiers
FT   CDS             complement(523930..525240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="envZ"
FT                   /locus_tag="RT0412"
FT                   /product="osmolarity sensor protein EnvZ"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:RT0412"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03889"
FT                   /db_xref="GOA:Q68WV3"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WV3"
FT                   /protein_id="AAU03889.1"
FT                   /translation="MAMHFISKLLPKTLFIRFMFIIIIPILIGQIVAIFLFYDRHWYNV
FT                   SYYTSTIIINEIESLIKEHKNNSRESTHLLENYLNLSYQFQFNKKLSIKQSKLSEPLTI
FT                   FKNILATKIYEKNIVKLNKENKIEVFLELKDGILYITFPAKLLLNPTVYIFVLWIISLT
FT                   IILLSVSIIFSKNQIKSILTLADSMDKFGRGILKSNNFKPSGALEIRNAGLAFLKMKAR
FT                   IEKQINKRTNMLAMISHDLRTPLTRMKLQLELMEENEAIKGFKQDILTMQQMINSYLDF
FT                   AKGESTEEFEEILLLPWIEHLLNKWPHINIEFIKSTNLNKLAVLMKPNSFERALSNLIG
FT                   NAIKYGTKIEISVKNNQSTVTIIIEDNGIGIDDMEKHLVFKPFYRSDKARQLDNSSNVG
FT                   LGLAITKEIINNHKGCIYLEDSKNLGGLLVRIEIPKI"
     MAMHFISKLL PKTLFIRFMF IIIIPILIGQ IVAIFLFYDR HWYNVSYYTS TIIINEIESL        60
     IKEHKNNSRE STHLLENYLN LSYQFQFNKK LSIKQSKLSE PLTIFKNILA TKIYEKNIVK       120
     LNKENKIEVF LELKDGILYI TFPAKLLLNP TVYIFVLWII SLTIILLSVS IIFSKNQIKS       180
     ILTLADSMDK FGRGILKSNN FKPSGALEIR NAGLAFLKMK ARIEKQINKR TNMLAMISHD       240
     LRTPLTRMKL QLELMEENEA IKGFKQDILT MQQMINSYLD FAKGESTEEF EEILLLPWIE       300
     HLLNKWPHIN IEFIKSTNLN KLAVLMKPNS FERALSNLIG NAIKYGTKIE ISVKNNQSTV       360
     TIIIEDNGIG IDDMEKHLVF KPFYRSDKAR QLDNSSNVGL GLAITKEIIN NHKGCIYLED       420
     SKNLGGLLVR IEIPKI                                                       436
//

If you have problems or comments...

PBIL Back to PBIL home page