(data stored in SCRATCH3701 zone)

EMBL: AE017197.FTSZ

AE017197.FTSZ        Location/Qualifiers
FT   CDS             833288..834646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsZ"
FT                   /locus_tag="RT0658"
FT                   /product="cell division protein FtsZ"
FT                   /db_xref="EnsemblGenomes-Gn:RT0658"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04119"
FT                   /db_xref="GOA:Q68W73"
FT                   /db_xref="InterPro:IPR000158"
FT                   /db_xref="InterPro:IPR003008"
FT                   /db_xref="InterPro:IPR008280"
FT                   /db_xref="InterPro:IPR018316"
FT                   /db_xref="InterPro:IPR020805"
FT                   /db_xref="InterPro:IPR024757"
FT                   /db_xref="InterPro:IPR036525"
FT                   /db_xref="InterPro:IPR037103"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68W73"
FT                   /protein_id="AAU04119.1"
FT                   /translation="MILNIKAPENIVLKPTITVFGVGGAGSNAVNNMIHANLQGANFVV
FT                   ANTDAQSLEHSLCINKIQLGVSTTRGLGAGASPEVGALAAQESENEIRSSLENSNMVFI
FT                   TAGMGGGTGTGSAPIIARIAKELGILTVGVVTKPFHFEGGHRMKTADKGLIELQQFVDT
FT                   LIVIPNQNLFRIANEQTTFADAFKMADDVLHAGVRGVTDLMIMPGLINLDFADIKAVMS
FT                   EMGKAMMGTGEDSGEDRAIKAAESAISNPLLDHSSMCGARGVLINITGGPDMTLFEVDN
FT                   AANRIREEVDNIDANIIFGSTFNPELKGIIRVSVVATGIDADKVPKYKLAIDENTNTVP
FT                   KETYNESMIQHTQIEEIPAFNNYSTENIEITDSSIKQNYTENEQELRLHVNAVNKPENN
FT                   SQKSSFLWKIWGSLRASNNQTLERKNVIVNTLDQDNKESDIHDIPAFLRKKRD"
     MILNIKAPEN IVLKPTITVF GVGGAGSNAV NNMIHANLQG ANFVVANTDA QSLEHSLCIN        60
     KIQLGVSTTR GLGAGASPEV GALAAQESEN EIRSSLENSN MVFITAGMGG GTGTGSAPII       120
     ARIAKELGIL TVGVVTKPFH FEGGHRMKTA DKGLIELQQF VDTLIVIPNQ NLFRIANEQT       180
     TFADAFKMAD DVLHAGVRGV TDLMIMPGLI NLDFADIKAV MSEMGKAMMG TGEDSGEDRA       240
     IKAAESAISN PLLDHSSMCG ARGVLINITG GPDMTLFEVD NAANRIREEV DNIDANIIFG       300
     STFNPELKGI IRVSVVATGI DADKVPKYKL AIDENTNTVP KETYNESMIQ HTQIEEIPAF       360
     NNYSTENIEI TDSSIKQNYT ENEQELRLHV NAVNKPENNS QKSSFLWKIW GSLRASNNQT       420
     LERKNVIVNT LDQDNKESDI HDIPAFLRKK RD                                     452
//

If you have problems or comments...

PBIL Back to PBIL home page