(data stored in SCRATCH3701 zone)

EMBL: AE017197.GLNH

AE017197.GLNH        Location/Qualifiers
FT   CDS             complement(180473..181198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnH"
FT                   /locus_tag="RT0139"
FT                   /product="glutamine-binding periplasmic protein GlnH"
FT                   /db_xref="EnsemblGenomes-Gn:RT0139"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03624"
FT                   /db_xref="GOA:Q68XL8"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XL8"
FT                   /protein_id="AAU03624.1"
FT                   /translation="MKFLKIFLLSFLLVSCEKKETEKTLIVGTAADNPPYEFIQDGEIV
FT                   GIDIDIIKAISQRLNKKIIIKNFDFNGLLAALISENIDVAIAALSVTQERSEYISFSDS
FT                   YAKARFAIIYRTGENIQNSKDLYNKIVGVQLGSVLEKKAQDLSHTMNIKVHALANHLML
FT                   VEELKAKVIDAIISEEFQGKKLKENNSNLETSTLEEFSSDFAIGMSKHSGLINEINSTI
FT                   NLLKKDGTINKIMKKWLGQ"
     MKFLKIFLLS FLLVSCEKKE TEKTLIVGTA ADNPPYEFIQ DGEIVGIDID IIKAISQRLN        60
     KKIIIKNFDF NGLLAALISE NIDVAIAALS VTQERSEYIS FSDSYAKARF AIIYRTGENI       120
     QNSKDLYNKI VGVQLGSVLE KKAQDLSHTM NIKVHALANH LMLVEELKAK VIDAIISEEF       180
     QGKKLKENNS NLETSTLEEF SSDFAIGMSK HSGLINEINS TINLLKKDGT INKIMKKWLG       240
     Q                                                                       241
//

If you have problems or comments...

PBIL Back to PBIL home page