(data stored in SCRATCH3701 zone)

EMBL: AE017197.GLNP

AE017197.GLNP        Location/Qualifiers
FT   CDS             152913..153569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnP"
FT                   /locus_tag="RT0118"
FT                   /product="glutamine transport system permease protein GlnP"
FT                   /db_xref="EnsemblGenomes-Gn:RT0118"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03604"
FT                   /db_xref="GOA:Q68XN8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XN8"
FT                   /protein_id="AAU03604.1"
FT                   /translation="MLKYLIKFYPKILFIIEGTLVTLKYSIIAVILGLVIGMLLAICKV
FT                   NKNCVLRLFANFYTSIFRGTPLLVQLSIIYFAAPYIISIKFSVFMAGVISFALNSGAYV
FT                   SEVIRAGINTIDKGQFEAAEALAIPKFLIMKDIILPQAINNIFPSLVNELINLIKESAI
FT                   ISMLGEMDLMRRAQIVSIETYNYFFPMLIAACCYYILVMLISFIAKIIEKKMIVN"
     MLKYLIKFYP KILFIIEGTL VTLKYSIIAV ILGLVIGMLL AICKVNKNCV LRLFANFYTS        60
     IFRGTPLLVQ LSIIYFAAPY IISIKFSVFM AGVISFALNS GAYVSEVIRA GINTIDKGQF       120
     EAAEALAIPK FLIMKDIILP QAINNIFPSL VNELINLIKE SAIISMLGEM DLMRRAQIVS       180
     IETYNYFFPM LIAACCYYIL VMLISFIAKI IEKKMIVN                               218
//

If you have problems or comments...

PBIL Back to PBIL home page