(data stored in SCRATCH3701 zone)

EMBL: AE017197.HSCB

AE017197.HSCB        Location/Qualifiers
FT   CDS             complement(243194..243694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hscB"
FT                   /locus_tag="RT0191"
FT                   /product="DnaJ-like chaperone protein HscB"
FT                   /db_xref="EnsemblGenomes-Gn:RT0191"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03675"
FT                   /db_xref="GOA:Q68XG7"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR004640"
FT                   /db_xref="InterPro:IPR009073"
FT                   /db_xref="InterPro:IPR036386"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XG7"
FT                   /protein_id="AAU03675.1"
FT                   /translation="MQNYFQLLELPQEYNIDLKILEKQYFAMQIKYHPDKAKTVQEKEQ
FT                   NLIIATELNKAYSTLKDALKRAEYMLLLQNINLNDEKIRSLLSPLELSIFWNEMERIEN
FT                   TILFSDLEKIKHKYELMQQQNINSLKQAFEKRNLSDATIHTSKLKYIRTLQNKLQEKIK
FT                   SCK"
     MQNYFQLLEL PQEYNIDLKI LEKQYFAMQI KYHPDKAKTV QEKEQNLIIA TELNKAYSTL        60
     KDALKRAEYM LLLQNINLND EKIRSLLSPL ELSIFWNEME RIENTILFSD LEKIKHKYEL       120
     MQQQNINSLK QAFEKRNLSD ATIHTSKLKY IRTLQNKLQE KIKSCK                      166
//

If you have problems or comments...

PBIL Back to PBIL home page