(data stored in SCRATCH3701 zone)

EMBL: AE017197.ILVE

AE017197.ILVE        Location/Qualifiers
FT   CDS             526015..526881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvE"
FT                   /locus_tag="RT0414"
FT                   /product="Branched-chain amino acid aminotransferase"
FT                   /EC_number="2.6.1.42"
FT                   /db_xref="EnsemblGenomes-Gn:RT0414"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03891"
FT                   /db_xref="GOA:Q9AKE5"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR033939"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9AKE5"
FT                   /protein_id="AAU03891.1"
FT                   /translation="MIKLEQICRYVWINGDLIPYQFARIHVLTHSLHYSGSVFEGERAY
FT                   NGKVFKLKEHTERLIQSAEALGLKVPYSVDEIIKAHEFLITHNNIKDAYIRPLIWCGDE
FT                   SLNITNPALSTNFLIASIPSMPMSCEQGVNLHVSRWRKAMPDSTPVQSKSAAQYNMAIT
FT                   SKKEAKALGYDDALLLDYEGFIAECTTTNIFFVKDTTLYTPIADRFLNGITRKTIIEIA
FT                   KNLCLEVKEERLKLAQIEYFTGCFVTGTAIEVQNISSIDLGDKKILFEDCKIADLLKKE
FT                   YLRIVRG"
     MIKLEQICRY VWINGDLIPY QFARIHVLTH SLHYSGSVFE GERAYNGKVF KLKEHTERLI        60
     QSAEALGLKV PYSVDEIIKA HEFLITHNNI KDAYIRPLIW CGDESLNITN PALSTNFLIA       120
     SIPSMPMSCE QGVNLHVSRW RKAMPDSTPV QSKSAAQYNM AITSKKEAKA LGYDDALLLD       180
     YEGFIAECTT TNIFFVKDTT LYTPIADRFL NGITRKTIIE IAKNLCLEVK EERLKLAQIE       240
     YFTGCFVTGT AIEVQNISSI DLGDKKILFE DCKIADLLKK EYLRIVRG                    288
//

If you have problems or comments...

PBIL Back to PBIL home page