(data stored in SCRATCH3701 zone)

EMBL: AE017197.ISCA1

AE017197.ISCA1       Location/Qualifiers
FT   CDS             90567..90899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iscA1"
FT                   /locus_tag="RT0069"
FT                   /product="iron-binding protein IscA/HesB"
FT                   /db_xref="EnsemblGenomes-Gn:RT0069"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03555"
FT                   /db_xref="GOA:Q68XT7"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR016092"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XT7"
FT                   /protein_id="AAU03555.1"
FT                   /translation="MTITITDRAFERIYELIELAQDKNLVLRVSVDSGGCSGLMYNYEL
FT                   VSKDNIEQDDYVFTKHNATIIIDAISQKFMLDCTLDFIEELGSSYFNVSNPHAKAKCGC
FT                   GNSFSV"
     MTITITDRAF ERIYELIELA QDKNLVLRVS VDSGGCSGLM YNYELVSKDN IEQDDYVFTK        60
     HNATIIIDAI SQKFMLDCTL DFIEELGSSY FNVSNPHAKA KCGCGNSFSV                  110
//

If you have problems or comments...

PBIL Back to PBIL home page