(data stored in SCRATCH3701 zone)

EMBL: AE017197.ISCS1

AE017197.ISCS1       Location/Qualifiers
FT   CDS             complement(603542..604774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iscS1"
FT                   /locus_tag="RT0473"
FT                   /product="cysteine desulfurase protein IscS/NifS"
FT                   /EC_number="4.4.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:RT0473"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03946"
FT                   /db_xref="GOA:Q68WP6"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR010240"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68WP6"
FT                   /protein_id="AAU03946.1"
FT                   /translation="MNQQLKNLTLPIYMDYQSTTPIDPRVMEAMLPYFTTKFGNPHSRS
FT                   HSFGWEAENAVENARSMIAKLIGADSKEIIFTSGATESNNLVIKGIAKFYGNKKNHIIT
FT                   LVSEHKCVLNACRYLEQEGIKITYLPIKPNGIIDLEILKNAITDQTLLVSVMAVNNEIG
FT                   VIQPLREIGKICRERSVFFHSDIAQGFGKIPINVNEYNIDLASISGHKIYGPKGIGALY
FT                   IRKKPRVRVTPLINGGGQERGMRSGTLPTPLIVGFGIAAEISYNEMEKDAQHVNYLFDR
FT                   FLNNIYSRIPEVYLNGDKDQRYKGNLNLSFAGVEGESIILAIKDLAVSSGSACTSASLE
FT                   PSYVLRSIGISEELAHTSIRFGIGRFTTEQEIDYAVNLICSKIDKLRKLSPLWEMMQEG
FT                   IDLKKIKWTAH"
     MNQQLKNLTL PIYMDYQSTT PIDPRVMEAM LPYFTTKFGN PHSRSHSFGW EAENAVENAR        60
     SMIAKLIGAD SKEIIFTSGA TESNNLVIKG IAKFYGNKKN HIITLVSEHK CVLNACRYLE       120
     QEGIKITYLP IKPNGIIDLE ILKNAITDQT LLVSVMAVNN EIGVIQPLRE IGKICRERSV       180
     FFHSDIAQGF GKIPINVNEY NIDLASISGH KIYGPKGIGA LYIRKKPRVR VTPLINGGGQ       240
     ERGMRSGTLP TPLIVGFGIA AEISYNEMEK DAQHVNYLFD RFLNNIYSRI PEVYLNGDKD       300
     QRYKGNLNLS FAGVEGESII LAIKDLAVSS GSACTSASLE PSYVLRSIGI SEELAHTSIR       360
     FGIGRFTTEQ EIDYAVNLIC SKIDKLRKLS PLWEMMQEGI DLKKIKWTAH                  410
//

If you have problems or comments...

PBIL Back to PBIL home page