(data stored in SCRATCH3701 zone)

EMBL: AE017197.ISCU

AE017197.ISCU        Location/Qualifiers
FT   CDS             complement(603100..603495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iscU"
FT                   /locus_tag="RT0472"
FT                   /product="iron-sulfur cofactor synthesis protein IscU/NifU"
FT                   /db_xref="EnsemblGenomes-Gn:RT0472"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03945"
FT                   /db_xref="GOA:Q68WP7"
FT                   /db_xref="InterPro:IPR002871"
FT                   /db_xref="InterPro:IPR011339"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WP7"
FT                   /protein_id="AAU03945.1"
FT                   /translation="MAYNKKVIDHYENPRNVGSLDKNKKNVGTGLVGAPACGDVMKLQI
FT                   EVDDDEIITDAKFKTFGCGSAIASSSLVTELVKGRSVEDAQEIKNTEIAKELSLPPVKL
FT                   HCSLLAEDAIKAAIADYKQKKGNKKDS"
     MAYNKKVIDH YENPRNVGSL DKNKKNVGTG LVGAPACGDV MKLQIEVDDD EIITDAKFKT        60
     FGCGSAIASS SLVTELVKGR SVEDAQEIKN TEIAKELSLP PVKLHCSLLA EDAIKAAIAD       120
     YKQKKGNKKD S                                                            131
//

If you have problems or comments...

PBIL Back to PBIL home page