(data stored in SCRATCH3701 zone)

EMBL: AE017197.LEPA

AE017197.LEPA        Location/Qualifiers
FT   CDS             334763..336565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lepA"
FT                   /locus_tag="RT0266"
FT                   /product="GTP-binding protein LepA"
FT                   /db_xref="EnsemblGenomes-Gn:RT0266"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03747"
FT                   /db_xref="GOA:Q68X95"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006297"
FT                   /db_xref="InterPro:IPR013842"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035654"
FT                   /db_xref="InterPro:IPR038363"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68X95"
FT                   /protein_id="AAU03747.1"
FT                   /translation="MNNQKYIRNFSIIAHIDHGKSTLADRLIEHCGGLNAREMSQQVLD
FT                   SMDIEKERGITIKAQTVRLVYKAKNGNTYYLNLMDTPGHVDFSYEVSRSLAACEGSLLV
FT                   VDSTQGVEAQTLANVYQAIANDHEIVPVLNKIDLAASEPEHVKKQIEDIIGIDASEAVL
FT                   ISAKNGIGIDSVLEAIINKLPSPKESSTDTLKALLVDSWYDPYLGVVILVRIIDGTLRK
FT                   NMRVKMIGTNSVYTVEHVGFFTPKKHISDVLYAGEIGFFTASIKRVSDCKVGDTITDEK
FT                   KSCEQALPGFKPNIPVVFCGFYPTDSAEFEHLKDSLAKLRLNDASFEYEMESSSALGVG
FT                   FRCGFLGLLHLEIIQERLSREFNLDLITTAPSVIYKIYMLDGESLEIHNPADLPDLQKI
FT                   ASMEEPWIKATIMVPDEFIGTVLSLCKEKRGIQLDHSYISNRAKIVYKLPLNEIVYDFY
FT                   DRLKSCSKGYASFEWQMDVYELSDLVNLRILVNGEVVDALSTIVHRSRAEQRGRALCVR
FT                   LKDLIPRQQIDIAIQASVGNRIIARETIKALRKDVLSKCYGGDISRKRKLLEKQKAGKK
FT                   KMRQYGNIEIPQSAFIAALQIGGE"
     MNNQKYIRNF SIIAHIDHGK STLADRLIEH CGGLNAREMS QQVLDSMDIE KERGITIKAQ        60
     TVRLVYKAKN GNTYYLNLMD TPGHVDFSYE VSRSLAACEG SLLVVDSTQG VEAQTLANVY       120
     QAIANDHEIV PVLNKIDLAA SEPEHVKKQI EDIIGIDASE AVLISAKNGI GIDSVLEAII       180
     NKLPSPKESS TDTLKALLVD SWYDPYLGVV ILVRIIDGTL RKNMRVKMIG TNSVYTVEHV       240
     GFFTPKKHIS DVLYAGEIGF FTASIKRVSD CKVGDTITDE KKSCEQALPG FKPNIPVVFC       300
     GFYPTDSAEF EHLKDSLAKL RLNDASFEYE MESSSALGVG FRCGFLGLLH LEIIQERLSR       360
     EFNLDLITTA PSVIYKIYML DGESLEIHNP ADLPDLQKIA SMEEPWIKAT IMVPDEFIGT       420
     VLSLCKEKRG IQLDHSYISN RAKIVYKLPL NEIVYDFYDR LKSCSKGYAS FEWQMDVYEL       480
     SDLVNLRILV NGEVVDALST IVHRSRAEQR GRALCVRLKD LIPRQQIDIA IQASVGNRII       540
     ARETIKALRK DVLSKCYGGD ISRKRKLLEK QKAGKKKMRQ YGNIEIPQSA FIAALQIGGE       600
//

If you have problems or comments...

PBIL Back to PBIL home page