(data stored in SCRATCH3701 zone)

EMBL: AE017197.MIAB1

AE017197.MIAB1       Location/Qualifiers
FT   CDS             511695..512960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="miaB1"
FT                   /locus_tag="RT0402"
FT                   /product="tRNA-methylthiotransferase (MiaB protein)"
FT                   /db_xref="EnsemblGenomes-Gn:RT0402"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03879"
FT                   /db_xref="GOA:Q68WW3"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR006467"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WW3"
FT                   /protein_id="AAU03879.1"
FT                   /translation="MENIIVRNNLRQEIVTFGCRLNIYESEIIRKNLELSGLDNVAIFN
FT                   TCAVTKSAEKQARQAIRKAKKNNPDLKIIVTGCSAQANPKMYGNMSEVDKVIGNEEKLL
FT                   SHYYQITDQKISVNDIMSVKETACHLVSSFDGKSRAFIQVQNGCDHNCTFCIIPYGRGR
FT                   SRSTPIGTIVAQVKHLVLKGFKEVVITGVDVTAYGSDLPGSPTFAQMIKRVLNLVPELK
FT                   RIRLSSIDIAEVDDEFFELIAYSKRIMPHFHISLQSGDDMILKRMKRRHNRASVIEFCQ
FT                   KLRAIRPEVSFGADIIAGFPTETNEMFENTRKLILEAELQYLHVFPYSEREGTPAIRMP
FT                   QVPKNIRKERAKILRQDGYNQLTEFFKKHIGQKVELLIENNNVAHTENFIPVKLDKYLA
FT                   IGQIFKAELVGIENGYMKCVLI"
     MENIIVRNNL RQEIVTFGCR LNIYESEIIR KNLELSGLDN VAIFNTCAVT KSAEKQARQA        60
     IRKAKKNNPD LKIIVTGCSA QANPKMYGNM SEVDKVIGNE EKLLSHYYQI TDQKISVNDI       120
     MSVKETACHL VSSFDGKSRA FIQVQNGCDH NCTFCIIPYG RGRSRSTPIG TIVAQVKHLV       180
     LKGFKEVVIT GVDVTAYGSD LPGSPTFAQM IKRVLNLVPE LKRIRLSSID IAEVDDEFFE       240
     LIAYSKRIMP HFHISLQSGD DMILKRMKRR HNRASVIEFC QKLRAIRPEV SFGADIIAGF       300
     PTETNEMFEN TRKLILEAEL QYLHVFPYSE REGTPAIRMP QVPKNIRKER AKILRQDGYN       360
     QLTEFFKKHI GQKVELLIEN NNVAHTENFI PVKLDKYLAI GQIFKAELVG IENGYMKCVL       420
     I                                                                       421
//

If you have problems or comments...

PBIL Back to PBIL home page