(data stored in SCRATCH3701 zone)

EMBL: AE017197.MRAZ

AE017197.MRAZ        Location/Qualifiers
FT   CDS             complement(721981..722430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mraZ"
FT                   /locus_tag="RT0558"
FT                   /product="protein MraZ"
FT                   /db_xref="EnsemblGenomes-Gn:RT0558"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04026"
FT                   /db_xref="GOA:Q68WG6"
FT                   /db_xref="InterPro:IPR003444"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR020603"
FT                   /db_xref="InterPro:IPR035642"
FT                   /db_xref="InterPro:IPR035644"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR038619"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68WG6"
FT                   /protein_id="AAU04026.1"
FT                   /translation="MNVFLSKYINGVDKKSRVTVPANYRAVLGKELFNGVIAYPSIRNN
FT                   CIEVCGIAHIEKLRKMIETLDPYSEERDAFETMIFGEAVQLAFDGEGRIILPQSLMKHA
FT                   DIEEQACFVGKGIIFEIWQPQNFEKYLSYAQNIAHEKRLTLRNVH"
     MNVFLSKYIN GVDKKSRVTV PANYRAVLGK ELFNGVIAYP SIRNNCIEVC GIAHIEKLRK        60
     MIETLDPYSE ERDAFETMIF GEAVQLAFDG EGRIILPQSL MKHADIEEQA CFVGKGIIFE       120
     IWQPQNFEKY LSYAQNIAHE KRLTLRNVH                                         149
//

If you have problems or comments...

PBIL Back to PBIL home page