(data stored in SCRATCH3701 zone)

EMBL: AE017197.MURC

AE017197.MURC        Location/Qualifiers
FT   CDS             301873..303369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murC"
FT                   /locus_tag="RT0239"
FT                   /product="UDP-N-acetylmuramate--L-alanine ligase"
FT                   /EC_number="6.3.2.8"
FT                   /note="Alanine-adding enzyme; L-Ala ligase;
FT                   L-alanine-adding enzyme; MurC synthetase;
FT                   UDP-MurNAc:L-alanine ligase; UDP-N-acetylmuramoyl-L-alanine
FT                   synthetase; UDP-N-acetylmuramoylalanine synthetase;
FT                   UDP-N-acetylmuramyl:L-alanine ligase;
FT                   UDP-acetylmuramyl-L-alanine synthetase; UDPMurNAc-L-alanine
FT                   synthetase; Uridine
FT                   5prime-diphosphate-N-acetylmuramyl-L-alanine synthetase;
FT                   Uridine diphosphate N-acetylmuramate:L-alanine ligase;
FT                   Uridine diphospho-N-acetylmuramoylalanine synthetase;
FT                   Uridine-diphosphate-N-acetylmuramate:L-alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:RT0239"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03720"
FT                   /db_xref="GOA:Q68XC2"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005758"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XC2"
FT                   /protein_id="AAU03720.1"
FT                   /translation="MLLLELKKTNQTLGTIHFIGIGGVGMSGIAEILHNLGYKVQGSDL
FT                   VENYNTKRLESYGIKIFLGHAKQNIKNVSYVVISSAIHQNNPEIKEALERKIPIIRRAE
FT                   MLAELMRLKCSVAVSGSHGKTTTTSLIACLFEAAGLYPTVINGGIINNKSTNAYLGSSN
FT                   YLIAEADESDATFIHIPSTIAIITNIDPEHLDYYQDFEILIGAFRSFITNLPFYGFAVC
FT                   CIDHKIVRKLVDDITERKIITYGIDAEDAHIIAFNINTDIASSTFDVKISLPNVLGTTI
FT                   IEKITIPTPGRHNILNSLAAIAVGIELDFGIKAIKNGFNNFKGVKRRFTKVAEYNQAVI
FT                   IDDYAHHPEEIKATLATAKNIANQQNGKVIAIFQPHRYSRIKYLFDDFMLCFADADILY
FT                   ITNIYAAGEKPIEGITGQSLVDKMTQNKYHDKANFLAELDDVVSVIIDHAASGDMIIMM
FT                   GAGNISSFANELDRRLLSQEILASSQNTDFDTSSYDKVIR"
     MLLLELKKTN QTLGTIHFIG IGGVGMSGIA EILHNLGYKV QGSDLVENYN TKRLESYGIK        60
     IFLGHAKQNI KNVSYVVISS AIHQNNPEIK EALERKIPII RRAEMLAELM RLKCSVAVSG       120
     SHGKTTTTSL IACLFEAAGL YPTVINGGII NNKSTNAYLG SSNYLIAEAD ESDATFIHIP       180
     STIAIITNID PEHLDYYQDF EILIGAFRSF ITNLPFYGFA VCCIDHKIVR KLVDDITERK       240
     IITYGIDAED AHIIAFNINT DIASSTFDVK ISLPNVLGTT IIEKITIPTP GRHNILNSLA       300
     AIAVGIELDF GIKAIKNGFN NFKGVKRRFT KVAEYNQAVI IDDYAHHPEE IKATLATAKN       360
     IANQQNGKVI AIFQPHRYSR IKYLFDDFML CFADADILYI TNIYAAGEKP IEGITGQSLV       420
     DKMTQNKYHD KANFLAELDD VVSVIIDHAA SGDMIIMMGA GNISSFANEL DRRLLSQEIL       480
     ASSQNTDFDT SSYDKVIR                                                     498
//

If you have problems or comments...

PBIL Back to PBIL home page