(data stored in SCRATCH3701 zone)

EMBL: AE017197.NUOE

AE017197.NUOE        Location/Qualifiers
FT   CDS             complement(435223..435735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoE"
FT                   /locus_tag="RT0342"
FT                   /product="NADH dehydrogenase (ubiquinone) subunit E"
FT                   /EC_number="1.6.5.3"
FT                   /note="Coenzyme Q reductase; Complex 1 dehydrogenase;
FT                   Complex I (NADH:Q1 oxidoreductase); Complex I (electron
FT                   transport chain); Complex I (mitochondrial electron
FT                   transport); DPNH-coenzyme Q reductase; DPNH-ubiquinone
FT                   reductase; Dihydronicotinamide adenine
FT                   dinucleotide-coenzyme Q reductase; Electron transfer
FT                   complex I; Mitochondrial electron transport complex 1;
FT                   Mitochondrial electron transport complex I; NADH coenzyme
FT                   Q1 reductase; NADH-CoQ oxidoreductase; NADH-CoQ reductase;
FT                   NADH-Q6 oxidoreductase; NADH-coenzyme Q oxidoreductase;
FT                   NADH-coenzyme Q reductase; NADH-ubiquinone oxidoreductase;
FT                   NADH-ubiquinone reductase; NADH-ubiquinone-1 reductase;
FT                   NADH:ubiquinone oxidoreductase complex; Reduced
FT                   nicotinamide adenine dinucleotide-coenzyme Q reductase;
FT                   Type 1 dehydrogenase; Ubiquinone reductase"
FT                   /db_xref="EnsemblGenomes-Gn:RT0342"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03822"
FT                   /db_xref="GOA:Q68X20"
FT                   /db_xref="InterPro:IPR002023"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR041921"
FT                   /db_xref="InterPro:IPR042128"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68X20"
FT                   /protein_id="AAU03822.1"
FT                   /translation="MNTKTTNFTFAFDKKNLNLAETIIKKYPPNGKRSAILPLLDLAQR
FT                   QNGGWLHISAIEYVANMLEMPYMRAYEVATFYSMFNLSPVGKYHIQVCTTTPCWLRGSD
FT                   DIMKICEKKLAIKHKETTKDQKFTLSEIECLGACVNAPVVQINDDYYEDLNEAKMEKLI
FT                   EQYLNDL"
     MNTKTTNFTF AFDKKNLNLA ETIIKKYPPN GKRSAILPLL DLAQRQNGGW LHISAIEYVA        60
     NMLEMPYMRA YEVATFYSMF NLSPVGKYHI QVCTTTPCWL RGSDDIMKIC EKKLAIKHKE       120
     TTKDQKFTLS EIECLGACVN APVVQINDDY YEDLNEAKME KLIEQYLNDL                  170
//

If you have problems or comments...

PBIL Back to PBIL home page