(data stored in SCRATCH3701 zone)

EMBL: AE017197.PARB

AE017197.PARB        Location/Qualifiers
FT   CDS             complement(95319..96179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="parB"
FT                   /locus_tag="RT0073"
FT                   /product="chromosome partitioning protein ParB (Spo0J
FT                   protein)"
FT                   /db_xref="EnsemblGenomes-Gn:RT0073"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03559"
FT                   /db_xref="GOA:Q68XT3"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="InterPro:IPR041468"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XT3"
FT                   /protein_id="AAU03559.1"
FT                   /translation="MVKNKGLGRGLSSLLGEEVLPIKSEIVQIINIDKIKPNENQPRKH
FT                   FEYNKIKELADSILNNGLLQPIIVDNNFQIIAGERRWRACKLAQVLEIPVIIKNFDTRE
FT                   SMETALIENIQRTDLTVMEEARGFKYLVDNFNYTVEKLAERLGKSRSHIANLLRLNNLP
FT                   QSIQDKLNENILSMGHARCLINHEYAEEIANHIINHDLNVRQTEALVRQWHKNEYKKST
FT                   NNTNKVGKLCFKDNIIDNDLELLVKALSKKFGIKITIDNCNLGGKLMFHYKDLEELDLI
FT                   LSKLN"
     MVKNKGLGRG LSSLLGEEVL PIKSEIVQII NIDKIKPNEN QPRKHFEYNK IKELADSILN        60
     NGLLQPIIVD NNFQIIAGER RWRACKLAQV LEIPVIIKNF DTRESMETAL IENIQRTDLT       120
     VMEEARGFKY LVDNFNYTVE KLAERLGKSR SHIANLLRLN NLPQSIQDKL NENILSMGHA       180
     RCLINHEYAE EIANHIINHD LNVRQTEALV RQWHKNEYKK STNNTNKVGK LCFKDNIIDN       240
     DLELLVKALS KKFGIKITID NCNLGGKLMF HYKDLEELDL ILSKLN                      286
//

If you have problems or comments...

PBIL Back to PBIL home page