(data stored in SCRATCH3701 zone)

EMBL: AE017197.PE10

AE017197.PE10        Location/Qualifiers
FT   CDS             10275..11348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0011"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0011"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03500"
FT                   /db_xref="GOA:Q68XZ2"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR022437"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XZ2"
FT                   /protein_id="AAU03500.1"
FT                   /translation="MKRILSFIFIILFFNSSYTAEKAAVITDYKSVFLPVITKNKKIKI
FT                   AIRSYLKNKESYFVLVDPDSFKTEIVLQELVILPVNKIEKENMLIKLNKTAYIKALNKY
FT                   NFIDQSLRSFKQDEFSNKFTKNVIVHEHKPNSKNSYLSTFMNSTVQQNYGATSSMYKVK
FT                   GQFLTIDMCPSSKNFEEDFFKKLVELSTKLKKTIPITICVSGLWINKHTEEFLWLLKQQ
FT                   ENGYLQITWVNHSFSHPYFKDKPLENNFLLSNKEDFENEVLEVGKILVSYNIAPSPFFR
FT                   FPGLVSDQILIAKLKDFGFIPLGSNAWLAKGEKVQDGSFILVHGNSNEKAGIDLIMPML
FT                   SELKLLPIEKAFLPTNL"
     MKRILSFIFI ILFFNSSYTA EKAAVITDYK SVFLPVITKN KKIKIAIRSY LKNKESYFVL        60
     VDPDSFKTEI VLQELVILPV NKIEKENMLI KLNKTAYIKA LNKYNFIDQS LRSFKQDEFS       120
     NKFTKNVIVH EHKPNSKNSY LSTFMNSTVQ QNYGATSSMY KVKGQFLTID MCPSSKNFEE       180
     DFFKKLVELS TKLKKTIPIT ICVSGLWINK HTEEFLWLLK QQENGYLQIT WVNHSFSHPY       240
     FKDKPLENNF LLSNKEDFEN EVLEVGKILV SYNIAPSPFF RFPGLVSDQI LIAKLKDFGF       300
     IPLGSNAWLA KGEKVQDGSF ILVHGNSNEK AGIDLIMPML SELKLLPIEK AFLPTNL          357
//

If you have problems or comments...

PBIL Back to PBIL home page