(data stored in SCRATCH3701 zone)

EMBL: AE017197.PE11

AE017197.PE11        Location/Qualifiers
FT   CDS             complement(11414..11848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0012"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0012"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03501"
FT                   /db_xref="GOA:Q68XZ1"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XZ1"
FT                   /protein_id="AAU03501.1"
FT                   /translation="MHTLNSEKETKNFAKLFAQNLKPNDIVLLNGDLGAGKTFFCREII
FT                   KHFCGKNTNIISPTFNLLQIYKTPNFNIYHYDMYRIKSPEEIYELGFEEALNGNLILIE
FT                   WSEIIKHLLTPPLIEVNLKILDNNKRLCSIKKENFLFDFL"
     MHTLNSEKET KNFAKLFAQN LKPNDIVLLN GDLGAGKTFF CREIIKHFCG KNTNIISPTF        60
     NLLQIYKTPN FNIYHYDMYR IKSPEEIYEL GFEEALNGNL ILIEWSEIIK HLLTPPLIEV       120
     NLKILDNNKR LCSIKKENFL FDFL                                              144
//

If you have problems or comments...

PBIL Back to PBIL home page