(data stored in SCRATCH3701 zone)

EMBL: AE017197.PE128

AE017197.PE128       Location/Qualifiers
FT   CDS             173310..173744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0133"
FT                   /product="rickettsial conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0133"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03618"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XM4"
FT                   /protein_id="AAU03618.1"
FT                   /translation="MSNVAENISKLPEEQEKINKLVDQYKNLTPQKQKEVDRKLKLYFT
FT                   KDELEQDELKSRMNRIRSNLSQQDQEKLHAGNSTIGEIAKDVLSLVKGIISLVENISKV
FT                   IKNPTGAIYEWFQNELNQVKPQQQNNHQFQSKPKAAAISR"
     MSNVAENISK LPEEQEKINK LVDQYKNLTP QKQKEVDRKL KLYFTKDELE QDELKSRMNR        60
     IRSNLSQQDQ EKLHAGNSTI GEIAKDVLSL VKGIISLVEN ISKVIKNPTG AIYEWFQNEL       120
     NQVKPQQQNN HQFQSKPKAA AISR                                              144
//

If you have problems or comments...

PBIL Back to PBIL home page