(data stored in SCRATCH3701 zone)

EMBL: AE017197.PE152

AE017197.PE152       Location/Qualifiers
FT   CDS             complement(197581..198021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0158"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0158"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03642"
FT                   /db_xref="InterPro:IPR005031"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XK0"
FT                   /protein_id="AAU03642.1"
FT                   /translation="MLSFQHTKILPYKPKKLFDLVWDIKSYPQFLPWCAAARIISENNQ
FT                   EVISELVIQLKGLSEKYHSRVINKITDNGIYLIDTVAISGPFEYLKNTWQFIPHSTGTE
FT                   LKFFIDFKMTSVILDKLIGSYFTIATKKMIVAFEKRAREVIK"
     MLSFQHTKIL PYKPKKLFDL VWDIKSYPQF LPWCAAARII SENNQEVISE LVIQLKGLSE        60
     KYHSRVINKI TDNGIYLIDT VAISGPFEYL KNTWQFIPHS TGTELKFFID FKMTSVILDK       120
     LIGSYFTIAT KKMIVAFEKR AREVIK                                            146
//

If you have problems or comments...

PBIL Back to PBIL home page