(data stored in SCRATCH3701 zone)

EMBL: AE017197.PE153

AE017197.PE153       Location/Qualifiers
FT   CDS             198319..199041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0159"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0159"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03643"
FT                   /db_xref="GOA:Q68XJ9"
FT                   /db_xref="InterPro:IPR006700"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XJ9"
FT                   /protein_id="AAU03643.1"
FT                   /translation="MKYNRIYINSHLAENSKIELVRDNVHYVKTVLRLKINDSLRIFNG
FT                   SDGEFLAHITKIGKNNISVVLTEQLKKAYIEPALTLAVAIIKSDKLMLIINMATQLGIT
FT                   KIIPLITSRCQFKTVNIERLIKCVIEATEQSERLNPPIIEHAITLKDYLKKNNNLILYA
FT                   NEHEKVKNSILRISSLLANDIAIIIGPEGGFTNDELELLALYKNTQSISLGSNILRTET
FT                   AAITVIAQVRLLQCQIAI"
     MKYNRIYINS HLAENSKIEL VRDNVHYVKT VLRLKINDSL RIFNGSDGEF LAHITKIGKN        60
     NISVVLTEQL KKAYIEPALT LAVAIIKSDK LMLIINMATQ LGITKIIPLI TSRCQFKTVN       120
     IERLIKCVIE ATEQSERLNP PIIEHAITLK DYLKKNNNLI LYANEHEKVK NSILRISSLL       180
     ANDIAIIIGP EGGFTNDELE LLALYKNTQS ISLGSNILRT ETAAITVIAQ VRLLQCQIAI       240
//

If you have problems or comments...

PBIL Back to PBIL home page