(data stored in SCRATCH3701 zone)

EMBL: AE017197.PE173

AE017197.PE173       Location/Qualifiers
FT   CDS             227799..228764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0179"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0179"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03663"
FT                   /db_xref="GOA:Q68XH9"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XH9"
FT                   /protein_id="AAU03663.1"
FT                   /translation="MKFYFSQIGKLFELIAAGKIKALLLYGPDKGYIEKICTRLVKNLN
FT                   MLLSSIEYEDLNILSFEILLNSHNFFGQKELIKIRSIGNSLDKNLKTILSSDYINFPVF
FT                   IGEDMNSSGSVKKFFETEEYLAAVACYHDDEAKIERIILAKLAKTNKVISKEAITYLKT
FT                   HLKGDHALICSEINKLIYFVHDVHEITLNHVLEVISSEITANGSNLAIYFSKKDYSNFL
FT                   QELDILKKQNINEVLIIRALIRHYLNLYIVLSKVKNGECLELAIKSLSPPIFYHNINDF
FT                   INIAHALSLTECLKTLKLLQQAEVDYKLNPASFDLFQSIL"
     MKFYFSQIGK LFELIAAGKI KALLLYGPDK GYIEKICTRL VKNLNMLLSS IEYEDLNILS        60
     FEILLNSHNF FGQKELIKIR SIGNSLDKNL KTILSSDYIN FPVFIGEDMN SSGSVKKFFE       120
     TEEYLAAVAC YHDDEAKIER IILAKLAKTN KVISKEAITY LKTHLKGDHA LICSEINKLI       180
     YFVHDVHEIT LNHVLEVISS EITANGSNLA IYFSKKDYSN FLQELDILKK QNINEVLIIR       240
     ALIRHYLNLY IVLSKVKNGE CLELAIKSLS PPIFYHNIND FINIAHALSL TECLKTLKLL       300
     QQAEVDYKLN PASFDLFQSI L                                                 321
//

If you have problems or comments...

PBIL Back to PBIL home page