(data stored in SCRATCH3701 zone)

EMBL: AE017197.PE175

AE017197.PE175       Location/Qualifiers
FT   CDS             230866..231252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0181"
FT                   /product="rickettsial conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0181"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03665"
FT                   /db_xref="GOA:Q68XH7"
FT                   /db_xref="InterPro:IPR007039"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XH7"
FT                   /protein_id="AAU03665.1"
FT                   /translation="MLIFLEVKYMNFHNRKLDEELIDYNISLRILFTILSVAIIMVAFD
FT                   SLATSVSDPVGDALCKLIKVFRGNTAKGIAVVGIIVLGIQTLRGKLQWEVALVVVTAII
FT                   ILFKAPDIVNMVSSDNNSSNCGVS"
     MLIFLEVKYM NFHNRKLDEE LIDYNISLRI LFTILSVAII MVAFDSLATS VSDPVGDALC        60
     KLIKVFRGNT AKGIAVVGII VLGIQTLRGK LQWEVALVVV TAIIILFKAP DIVNMVSSDN       120
     NSSNCGVS                                                                128
//

If you have problems or comments...

PBIL Back to PBIL home page