(data stored in SCRATCH3701 zone)

EMBL: AE017197.PE178

AE017197.PE178       Location/Qualifiers
FT   CDS             233126..233230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0184"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0184"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03668"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XH4"
FT                   /protein_id="AAU03668.1"
FT                   /translation="MVEENNKLHQVPINDYWSINVDNDNLFLVIVHIC"
     MVEENNKLHQ VPINDYWSIN VDNDNLFLVI VHIC                                    34
//

If you have problems or comments...

PBIL Back to PBIL home page