(data stored in SCRATCH3701 zone)

EMBL: AE017197.PE181

AE017197.PE181       Location/Qualifiers
FT   CDS             complement(239015..239956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0187"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0187"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03671"
FT                   /db_xref="InterPro:IPR011852"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XH1"
FT                   /protein_id="AAU03671.1"
FT                   /translation="MNNLKLLTIISIFLICSNIYAATKIIKIGTGSILKGYYAIGLDLC
FT                   KTITSDYKNNEHIKCEVVITNGSIENLKLLQQGKIDLALVQANIAVEAYEGIGYYRNQE
FT                   KMQNLRQVLNLHDEFFTVIVRDDNRIKVFADIDGKKITNGPEFSSSNITYDTIRSLYKF
FT                   SNESEELNINYEDSIEKFCNKEIDAIIMMIGHFNPLVNLISHKCKINFVSIENDKITEL
FT                   IKQNRAFNKAILNKSLYPWITDYHTTVKVSAILVTRDEVNSDILDKFIGAFHRNVANFK
FT                   LSNYLLNNLDIHYFVDTKNFVLPKHNAVRSKN"
     MNNLKLLTII SIFLICSNIY AATKIIKIGT GSILKGYYAI GLDLCKTITS DYKNNEHIKC        60
     EVVITNGSIE NLKLLQQGKI DLALVQANIA VEAYEGIGYY RNQEKMQNLR QVLNLHDEFF       120
     TVIVRDDNRI KVFADIDGKK ITNGPEFSSS NITYDTIRSL YKFSNESEEL NINYEDSIEK       180
     FCNKEIDAII MMIGHFNPLV NLISHKCKIN FVSIENDKIT ELIKQNRAFN KAILNKSLYP       240
     WITDYHTTVK VSAILVTRDE VNSDILDKFI GAFHRNVANF KLSNYLLNNL DIHYFVDTKN       300
     FVLPKHNAVR SKN                                                          313
//

If you have problems or comments...

PBIL Back to PBIL home page