(data stored in SCRATCH3701 zone)

EMBL: AE017197.PE182

AE017197.PE182       Location/Qualifiers
FT   CDS             complement(239961..241028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0188"
FT                   /product="rickettsial conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0188"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03672"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XH0"
FT                   /protein_id="AAU03672.1"
FT                   /translation="MIRKILLFVFLAFTIIWFSTAYTIKNNVVSLIKNSESDNLRIYYN
FT                   AVKFSGYPFNWKIHITDPKVKLIDHVNSQEFTCKNIVINISFNTKRAALNFGPFIKVDN
FT                   YGDKTFTYNVHSNNDINGIGKFNKPLYKVSQDDSLKEILKSIKFNNKALSIFKGHQEIF
FT                   KINDLAFLIQKHNLASQENISLFLNMHYYSENDILNFKNANVDMATSFKFAKNGKDASI
FT                   LENFNIERFIFICDNDSKVNLNGTLQFFTNKLPKGILSFELENYNAIVDKLLPNNILFS
FT                   KKTIKTIIAKAMNKTSDEQLNTDNNNTNSVYNNIKNAKFDIAFSDKGINIGSINLLELT
FT                   LGEYKAEKNTENNPN"
     MIRKILLFVF LAFTIIWFST AYTIKNNVVS LIKNSESDNL RIYYNAVKFS GYPFNWKIHI        60
     TDPKVKLIDH VNSQEFTCKN IVINISFNTK RAALNFGPFI KVDNYGDKTF TYNVHSNNDI       120
     NGIGKFNKPL YKVSQDDSLK EILKSIKFNN KALSIFKGHQ EIFKINDLAF LIQKHNLASQ       180
     ENISLFLNMH YYSENDILNF KNANVDMATS FKFAKNGKDA SILENFNIER FIFICDNDSK       240
     VNLNGTLQFF TNKLPKGILS FELENYNAIV DKLLPNNILF SKKTIKTIIA KAMNKTSDEQ       300
     LNTDNNNTNS VYNNIKNAKF DIAFSDKGIN IGSINLLELT LGEYKAEKNT ENNPN            355
//

If you have problems or comments...

PBIL Back to PBIL home page