(data stored in SCRATCH3701 zone)

EMBL: AE017197.PE193

AE017197.PE193       Location/Qualifiers
FT   CDS             255711..255851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0199"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0199"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03683"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XF9"
FT                   /protein_id="AAU03683.1"
FT                   /translation="MSNLKQTKAILKLYTYTYGKSVKSANSNILDKFNKNGYLIINNSN
FT                   L"
     MSNLKQTKAI LKLYTYTYGK SVKSANSNIL DKFNKNGYLI INNSNL                       46
//

If you have problems or comments...

PBIL Back to PBIL home page