(data stored in SCRATCH3701 zone)

EMBL: AE017197.PE194

AE017197.PE194       Location/Qualifiers
FT   CDS             complement(258437..258853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0201"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0201"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03684"
FT                   /protein_id="AAU03684.1"
FT                   /translation="MHSAVIPSVLSYPAVPLARQLVHQGYVHLGPLVLKADPLKLPTPT
FT                   ADRDRTVSRRSKPSSRTTLIGEQPNPWDLLQPQDVMSRHRGAKRFRRYGRLEIISLLSP
FT                   EYLLFVERWPFHSGPPDHYDRLSSLLVLSDSQSG"
     MHSAVIPSVL SYPAVPLARQ LVHQGYVHLG PLVLKADPLK LPTPTADRDR TVSRRSKPSS        60
     RTTLIGEQPN PWDLLQPQDV MSRHRGAKRF RRYGRLEIIS LLSPEYLLFV ERWPFHSGPP       120
     DHYDRLSSLL VLSDSQSG                                                     138
//

If you have problems or comments...

PBIL Back to PBIL home page