(data stored in SCRATCH3701 zone)

EMBL: AE017197.PE205

AE017197.PE205       Location/Qualifiers
FT   CDS             complement(275036..275173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0213"
FT                   /product="rickettsial conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0213"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03695"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XE7"
FT                   /protein_id="AAU03695.1"
FT                   /translation="MINIIAKHETHLLKILKISIVRYKKLSIRHNKLSSMLIQTHKIYS
FT                   "
     MINIIAKHET HLLKILKISI VRYKKLSIRH NKLSSMLIQT HKIYS                        45
//

If you have problems or comments...

PBIL Back to PBIL home page