(data stored in SCRATCH3701 zone)

EMBL: AE017197.PE206

AE017197.PE206       Location/Qualifiers
FT   CDS             complement(276535..276882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0214"
FT                   /product="rickettsial conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0214"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03696"
FT                   /db_xref="InterPro:IPR022589"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XE6"
FT                   /protein_id="AAU03696.1"
FT                   /translation="MYTKIVAHKKNILPAKGNNIDDSQNVALNSQKPENKKLTLQEKIE
FT                   LSWKFLYDITEIILNKFSKEDVAQVNKCGQILFENGVRYGHVVDIVIPHVRSHTQSVEQ
FT                   EQSKSKKALRM"
     MYTKIVAHKK NILPAKGNNI DDSQNVALNS QKPENKKLTL QEKIELSWKF LYDITEIILN        60
     KFSKEDVAQV NKCGQILFEN GVRYGHVVDI VIPHVRSHTQ SVEQEQSKSK KALRM            115
//

If you have problems or comments...

PBIL Back to PBIL home page