(data stored in SCRATCH3701 zone)

EMBL: AE017197.PE209

AE017197.PE209       Location/Qualifiers
FT   CDS             279727..280140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0217"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0217"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03699"
FT                   /db_xref="InterPro:IPR019632"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XE3"
FT                   /protein_id="AAU03699.1"
FT                   /translation="MSKENKKNQDMSIEEILKSIKGIINEHKNPVYENYSADEDILELT
FT                   DIVNQDEEEKLISTKSASEVEEIFKNFTDTIKDKKLNNNFSSKNALEELVIEMLKPELK
FT                   VWLDKNLPILVKELVEIEIKKLVQYSKRDGSNY"
     MSKENKKNQD MSIEEILKSI KGIINEHKNP VYENYSADED ILELTDIVNQ DEEEKLISTK        60
     SASEVEEIFK NFTDTIKDKK LNNNFSSKNA LEELVIEMLK PELKVWLDKN LPILVKELVE       120
     IEIKKLVQYS KRDGSNY                                                      137
//

If you have problems or comments...

PBIL Back to PBIL home page