(data stored in SCRATCH3701 zone)

EMBL: AE017197.PE210

AE017197.PE210       Location/Qualifiers
FT   CDS             280273..282033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0218"
FT                   /product="rickettsial conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0218"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03700"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XE2"
FT                   /protein_id="AAU03700.1"
FT                   /translation="MLNKLCEILFLINLLLVTGQGYASPPPLPQSLPIVAIDTPDKEDK
FT                   DVSTNFNISFFEKLKQFFSKQKKTNISSQQEKGQTKAIHKESQQIDPRELNENEQSEPF
FT                   IDVGSVILPSVANIHSKFEYENSTNLASNYNTQDMQVTQQELNSTEASESFIDIGNTKF
FT                   ISATNNEMYKEAVLPNDYKKTNLDFNIITLNVLKPVIPTSQDMMDVVPLQQPVQIYKPT
FT                   NLTSIPKLFNHDTNLNNVEKNLESTMSNMTTISPNMLSVPTTQDTIPTTLNITVPTTPT
FT                   TETHVNVPSSTMMHSNNHSTQPITTISINTPVDTSSTVVTATESSMAINNSQERFVSTS
FT                   EATKKQDWYTPIIPVLVVDPNKSRPNSLALEKKIDNDQIINNQAKSYPVSSSNVTLQKQ
FT                   NDKVNNETSELAKEFVKNETQMLFLPDDDIVLGKLTEHATLEQMDMYGYIKLFQKKEGW
FT                   IASMGKRKLVESFIKYDIDINKNKDIYSNLSYYSAVDNAFRAVARNNLFELRALLDVYP
FT                   ILQEKNSTGETLLTAAIYNDNYYLAKFLVIRGIKTSVLKKDECKYPLDIASSQGNTNIV
FT                   CMLMKAKGYN"
     MLNKLCEILF LINLLLVTGQ GYASPPPLPQ SLPIVAIDTP DKEDKDVSTN FNISFFEKLK        60
     QFFSKQKKTN ISSQQEKGQT KAIHKESQQI DPRELNENEQ SEPFIDVGSV ILPSVANIHS       120
     KFEYENSTNL ASNYNTQDMQ VTQQELNSTE ASESFIDIGN TKFISATNNE MYKEAVLPND       180
     YKKTNLDFNI ITLNVLKPVI PTSQDMMDVV PLQQPVQIYK PTNLTSIPKL FNHDTNLNNV       240
     EKNLESTMSN MTTISPNMLS VPTTQDTIPT TLNITVPTTP TTETHVNVPS STMMHSNNHS       300
     TQPITTISIN TPVDTSSTVV TATESSMAIN NSQERFVSTS EATKKQDWYT PIIPVLVVDP       360
     NKSRPNSLAL EKKIDNDQII NNQAKSYPVS SSNVTLQKQN DKVNNETSEL AKEFVKNETQ       420
     MLFLPDDDIV LGKLTEHATL EQMDMYGYIK LFQKKEGWIA SMGKRKLVES FIKYDIDINK       480
     NKDIYSNLSY YSAVDNAFRA VARNNLFELR ALLDVYPILQ EKNSTGETLL TAAIYNDNYY       540
     LAKFLVIRGI KTSVLKKDEC KYPLDIASSQ GNTNIVCMLM KAKGYN                      586
//

If you have problems or comments...

PBIL Back to PBIL home page