(data stored in SCRATCH3701 zone)

EMBL: AE017197.PE220

AE017197.PE220       Location/Qualifiers
FT   CDS             complement(293404..294756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0229"
FT                   /product="response regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0229"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03710"
FT                   /db_xref="GOA:Q68XD2"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XD2"
FT                   /protein_id="AAU03710.1"
FT                   /translation="MTTILVVDDIETNIKLLTAKLLKEYYTVLTANSGKEALSILKKEK
FT                   IDTILLDVMMPEMDGFEVCKIIKTDPGTTHIPVVMITALSDIDDRVKGLEAGADEFLIK
FT                   PINDTALFVRLKSLSRMKSLIDELKLRNSTNALLGVTNIEIHDNLTDKKILLINDDVVQ
FT                   AKNIKQILVKLTKYVKVISNSDELDIINEYTPDLVIISSTLENEDPLRISVILRGKAEI
FT                   SGVVIILQIDEDGMPLVVKGIELGINDYFIYPIEENELLARIRTQLRRKQYQDNLRNDL
FT                   EQSVNLAAKDGLTGLFNRRYFDIHLKQMIEKANKENIKLYLLMCDIDNFKHVNDTYGHQ
FT                   AGDKVLTIVSRILKNTLRVTDLIARFGGEEFTILLTDIDISKAIETAERIRVKIEYMDF
FT                   YIEGQIEPLKKTISIGVTEYKKEESIESIIKRADKAMYKAKTTGKNKVVQL"
     MTTILVVDDI ETNIKLLTAK LLKEYYTVLT ANSGKEALSI LKKEKIDTIL LDVMMPEMDG        60
     FEVCKIIKTD PGTTHIPVVM ITALSDIDDR VKGLEAGADE FLIKPINDTA LFVRLKSLSR       120
     MKSLIDELKL RNSTNALLGV TNIEIHDNLT DKKILLINDD VVQAKNIKQI LVKLTKYVKV       180
     ISNSDELDII NEYTPDLVII SSTLENEDPL RISVILRGKA EISGVVIILQ IDEDGMPLVV       240
     KGIELGINDY FIYPIEENEL LARIRTQLRR KQYQDNLRND LEQSVNLAAK DGLTGLFNRR       300
     YFDIHLKQMI EKANKENIKL YLLMCDIDNF KHVNDTYGHQ AGDKVLTIVS RILKNTLRVT       360
     DLIARFGGEE FTILLTDIDI SKAIETAERI RVKIEYMDFY IEGQIEPLKK TISIGVTEYK       420
     KEESIESIIK RADKAMYKAK TTGKNKVVQL                                        450
//

If you have problems or comments...

PBIL Back to PBIL home page