(data stored in SCRATCH3701 zone)

EMBL: AE017197.PE229

AE017197.PE229       Location/Qualifiers
FT   CDS             300486..301709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0238"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0238"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03719"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XC3"
FT                   /protein_id="AAU03719.1"
FT                   /translation="MIKIAMSELITDYKNLQYEIDKLQKGVCFACRLINYDEIEFIEQD
FT                   KHFIIQDLDQIIKNVSKELNIFATFKIINEDRILFILNTTDSDLIKNFARKLYLLSQLY
FT                   INEERPAIYMNCYIASIKFTTVMNNAESIAKALNMLLSQNNNYYYREYSSTAHDLENIR
FT                   KSNLQLNLLRKALVKKTMRFAYQPIINRNTMKIHYYECLLRIPDENGVYISVGQIIPIA
FT                   ENKGLIFIIDQIVLEMTINELARNPNLMLAVNISNIGTSDEALCEIAENLLKVHNVRDR
FT                   LIIEITETSFNENYDKITLFINKLRKYGCKFALDDFGSGFTSFKQLQSLPIDIIKIDGK
FT                   YVRSITSDVQSRYFVERLIRISEDLGIATVAEFVENGEIAQFLIDLKVSGLQGNFYSEA
FT                   KFDRVDEV"
     MIKIAMSELI TDYKNLQYEI DKLQKGVCFA CRLINYDEIE FIEQDKHFII QDLDQIIKNV        60
     SKELNIFATF KIINEDRILF ILNTTDSDLI KNFARKLYLL SQLYINEERP AIYMNCYIAS       120
     IKFTTVMNNA ESIAKALNML LSQNNNYYYR EYSSTAHDLE NIRKSNLQLN LLRKALVKKT       180
     MRFAYQPIIN RNTMKIHYYE CLLRIPDENG VYISVGQIIP IAENKGLIFI IDQIVLEMTI       240
     NELARNPNLM LAVNISNIGT SDEALCEIAE NLLKVHNVRD RLIIEITETS FNENYDKITL       300
     FINKLRKYGC KFALDDFGSG FTSFKQLQSL PIDIIKIDGK YVRSITSDVQ SRYFVERLIR       360
     ISEDLGIATV AEFVENGEIA QFLIDLKVSG LQGNFYSEAK FDRVDEV                     407
//

If you have problems or comments...

PBIL Back to PBIL home page