(data stored in SCRATCH3701 zone)

EMBL: AE017197.PE235

AE017197.PE235       Location/Qualifiers
FT   CDS             complement(307688..308194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0244"
FT                   /product="rickettsial conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0244"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03725"
FT                   /db_xref="GOA:Q68XB7"
FT                   /db_xref="InterPro:IPR002810"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XB7"
FT                   /protein_id="AAU03725.1"
FT                   /translation="MINNSLNEIWLIIGIICILVECYIVQNIGFLFLGLGALSNSLVVY
FT                   NNPLVTLINQITFFGVFSLLWFCILYFPLKKYIYNKTNRTQNYSDMIGKTVEVYSPTVS
FT                   ANTIGQVKWSGTIMNAYLAPNEIDAKAGEQLFITRVKGNILICSKHRLNNNSYNNINAN
FT                   LYKKL"
     MINNSLNEIW LIIGIICILV ECYIVQNIGF LFLGLGALSN SLVVYNNPLV TLINQITFFG        60
     VFSLLWFCIL YFPLKKYIYN KTNRTQNYSD MIGKTVEVYS PTVSANTIGQ VKWSGTIMNA       120
     YLAPNEIDAK AGEQLFITRV KGNILICSKH RLNNNSYNNI NANLYKKL                    168
//

If you have problems or comments...

PBIL Back to PBIL home page