(data stored in SCRATCH3701 zone)

EMBL: AE017197.PE238

AE017197.PE238       Location/Qualifiers
FT   CDS             complement(310675..311820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0247"
FT                   /product="rickettsial conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0247"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03728"
FT                   /db_xref="GOA:Q68XB4"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XB4"
FT                   /protein_id="AAU03728.1"
FT                   /translation="MTLKNDYKTIFFSLFGIFIFSCINAINFYNFKIFLLIKNLGGEQI
FT                   NNINQTKFIGSIIAGFSLTQLINKLSNKIIILISLSLLIICTINLIILNNYTLIKINFI
FT                   LINFGIFSYFTSITLDIIEISKDKKYLFLACIILLWACGNLMIDLLNPFIKLTNNTMVI
FT                   CALLYCINILTEFRHDNHTSNKLHLNFKFSSLIKNIELQLLTGFIVSYITLNILWYYEA
FT                   FALKKQLALINLKLILKYIFLAICFSIIPICYILNKINKYFANLALNTILLICFILLPI
FT                   HGTNKNLNILYIILIGNCLGAIFICNILILIAKFRDYELRTALLSYFSMCSIGIYAGAL
FT                   SSHIPYGTINGSDVLFSVFSIIGSFVTYHFWYFIKYKLYRF"
     MTLKNDYKTI FFSLFGIFIF SCINAINFYN FKIFLLIKNL GGEQINNINQ TKFIGSIIAG        60
     FSLTQLINKL SNKIIILISL SLLIICTINL IILNNYTLIK INFILINFGI FSYFTSITLD       120
     IIEISKDKKY LFLACIILLW ACGNLMIDLL NPFIKLTNNT MVICALLYCI NILTEFRHDN       180
     HTSNKLHLNF KFSSLIKNIE LQLLTGFIVS YITLNILWYY EAFALKKQLA LINLKLILKY       240
     IFLAICFSII PICYILNKIN KYFANLALNT ILLICFILLP IHGTNKNLNI LYIILIGNCL       300
     GAIFICNILI LIAKFRDYEL RTALLSYFSM CSIGIYAGAL SSHIPYGTIN GSDVLFSVFS       360
     IIGSFVTYHF WYFIKYKLYR F                                                 381
//

If you have problems or comments...

PBIL Back to PBIL home page