(data stored in SCRATCH3701 zone)

EMBL: AE017197.PE246

AE017197.PE246       Location/Qualifiers
FT   CDS             324421..324927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0255"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0255"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03736"
FT                   /db_xref="GOA:Q68XA6"
FT                   /db_xref="InterPro:IPR005632"
FT                   /db_xref="InterPro:IPR024930"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XA6"
FT                   /protein_id="AAU03736.1"
FT                   /translation="MITEAQNVAIKGDNFKVRVAVADVQSILEGSIAIKDLRNKIEKLN
FT                   HKIQEDIAAKEAEFKPLEEKLLNERSNLSNDEFENRVNEFNAKVSYVRKEIQIRKTKLE
FT                   QAHAEAMSRVHETTITIISELAEKYNLNLVIPSAQVLYAKNNLNITSEVTFMLNERLKE
FT                   VSINY"
     MITEAQNVAI KGDNFKVRVA VADVQSILEG SIAIKDLRNK IEKLNHKIQE DIAAKEAEFK        60
     PLEEKLLNER SNLSNDEFEN RVNEFNAKVS YVRKEIQIRK TKLEQAHAEA MSRVHETTIT       120
     IISELAEKYN LNLVIPSAQV LYAKNNLNIT SEVTFMLNER LKEVSINY                    168
//

If you have problems or comments...

PBIL Back to PBIL home page