(data stored in SCRATCH3701 zone)

EMBL: AE017197.PE248

AE017197.PE248       Location/Qualifiers
FT   CDS             326584..326904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0257"
FT                   /product="rickettsial conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0257"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03738"
FT                   /db_xref="GOA:Q68XA4"
FT                   /db_xref="InterPro:IPR005133"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XA4"
FT                   /protein_id="AAU03738.1"
FT                   /translation="MILYYIGILVIIIGVFAIFSGIIGFFRFPDFYTKLHAASVIESFG
FT                   VPICLIGFALIESDIVNSIKLILAALLILLLNPVATHALGKASLLMKNRTYHTVLLKKI
FT                   RK"
     MILYYIGILV IIIGVFAIFS GIIGFFRFPD FYTKLHAASV IESFGVPICL IGFALIESDI        60
     VNSIKLILAA LLILLLNPVA THALGKASLL MKNRTYHTVL LKKIRK                      106
//

If you have problems or comments...

PBIL Back to PBIL home page