(data stored in SCRATCH3701 zone)

EMBL: AE017197.PE251

AE017197.PE251       Location/Qualifiers
FT   CDS             328758..329216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0260"
FT                   /product="rickettsial conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0260"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03741"
FT                   /db_xref="GOA:Q68XA1"
FT                   /db_xref="InterPro:IPR022714"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XA1"
FT                   /protein_id="AAU03741.1"
FT                   /translation="MWRALRRLIAANPMGFFLWSIITKWYLIIAVASLITLYYTVLGLK
FT                   KIGFIDYFGRETEDILSQSKAVAQNCIPKLKLVNGKLPLREFWNCLSDPGEYQHEEVTG
FT                   AKVLEDEINKFMQKQADSISDTVPPIINPYEKLENQNNLNNALNDNNR"
     MWRALRRLIA ANPMGFFLWS IITKWYLIIA VASLITLYYT VLGLKKIGFI DYFGRETEDI        60
     LSQSKAVAQN CIPKLKLVNG KLPLREFWNC LSDPGEYQHE EVTGAKVLED EINKFMQKQA       120
     DSISDTVPPI INPYEKLENQ NNLNNALNDN NR                                     152
//

If you have problems or comments...

PBIL Back to PBIL home page