(data stored in SCRATCH3701 zone)

EMBL: AE017197.PE255

AE017197.PE255       Location/Qualifiers
FT   CDS             332686..333177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0264"
FT                   /product="HSP22-like heat shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0264"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03745"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR031107"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68X97"
FT                   /protein_id="AAU03745.1"
FT                   /translation="MLKYIPAIFAIILSSNIAIASKNYDYINATPLRQVADLIDSHITN
FT                   IDHLFNNRLMFYESSSIKSKFITKDKQYVIIMEVPGFDKNQIKVKLNGKKLFIAGNIEE
FT                   KNKANDSDNYMNKNFNYVISLYEDVDQTNISARLKNGILTIILPRIEVKEQDAKEITIN
FT                   "
     MLKYIPAIFA IILSSNIAIA SKNYDYINAT PLRQVADLID SHITNIDHLF NNRLMFYESS        60
     SIKSKFITKD KQYVIIMEVP GFDKNQIKVK LNGKKLFIAG NIEEKNKAND SDNYMNKNFN       120
     YVISLYEDVD QTNISARLKN GILTIILPRI EVKEQDAKEI TIN                         163
//

If you have problems or comments...

PBIL Back to PBIL home page